Loading...
Statistics
Advertisement

online-management.ch
www.krankentaggeld.ch/

Krankentaggeld.ch

Advertisement
Conversion Technology Metas Server
Krankentaggeld.ch is hosted in Switzerland . Krankentaggeld.ch uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Php, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Krankentaggeld.ch

Technology

Number of occurences: 3
  • CSS
  • Html
  • Php

Advertisement

Server Type

  • Apache

Powered by

  • PleskLin

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Krankentaggeld.ch

SSL certificate

    • name: /C=CH/ST=ZH/L=Zuerich/O=METANET AG/CN=*.sui-inter.net
    • subject:
      • C: CH
      • ST: ZH
      • L: Zuerich
      • O: METANET AG
      • CN: *.sui-inter.net
    • hash: c2dde7f0
    • issuer:
      • C: US
      • O: DigiCert Inc
      • CN: DigiCert SHA2 Secure Server CA
    • version: 2
    • serialNumber: 15504670849024468697823748472352170952
    • validFrom: 140922000000Z
    • validTo: 171129120000Z
    • validFrom_time_t: 1411344000
    • validTo_time_t: 1511956800
    • extensions:
      • authorityKeyIdentifier: keyid:0F:80:61:1C:82:31:61:D5:2F:28:E7:8D:46:38:B4:2C:E1:C6:D9:E2
      • subjectKeyIdentifier: 3E:88:0F:19:4E:AA:ED:9D:73:4C:45:F1:AF:DF:34:52:E2:81:56:A6
      • subjectAltName: DNS:*.sui-inter.net, DNS:sui-inter.net
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl3.digicert.com/ssca-sha2-g2.crl Full Name: URI:http://crl4.digicert.com/ssca-sha2-g2.crl
      • certificatePolicies: Policy: 2.16.840.1.114412.1.1 CPS: https://www.digicert.com/CPS
      • authorityInfoAccess: OCSP - URI:http://ocsp.digicert.com CA Issuers - URI:http://cacerts.digicert.com/DigiCertSHA2SecureServerCA.crt
      • basicConstraints: CA:FALSE

Meta - Krankentaggeld.ch

Number of occurences: 0

Server / Hosting

  • IP: 80.74.152.50
  • Latitude: 47.14
  • Longitude: 8.16
  • Country: Switzerland

Rname

  • ns2.informatiker.ch
  • ns1.informatiker.ch
  • mail.krankentaggeld.ch

Target

  • hostmaster.metanet.ch

HTTP Header Response

HTTP/1.1 200 OK Date: Tue, 13 Sep 2016 18:04:03 GMT Server: Apache X-Powered-By: PleskLin Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_mf40 Transfer-Encoding: chunked Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

DNS

host: krankentaggeld.ch
  1. class: IN
  2. ttl: 43200
  3. type: A
  4. ip: 80.74.152.50
host: krankentaggeld.ch
  1. class: IN
  2. ttl: 43200
  3. type: NS
  4. target: ns2.informatiker.ch
host: krankentaggeld.ch
  1. class: IN
  2. ttl: 43200
  3. type: NS
  4. target: ns1.informatiker.ch
host: krankentaggeld.ch
  1. class: IN
  2. ttl: 43200
  3. type: SOA
  4. mname: ns.ch-inter.net
  5. rname: hostmaster.metanet.ch
  6. serial: 2002010101
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 43200
host: krankentaggeld.ch
  1. class: IN
  2. ttl: 43200
  3. type: MX
  4. pri: 10
  5. target: mail.krankentaggeld.ch

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.rankentaggeld.ch, www.ktrankentaggeld.ch, www.trankentaggeld.ch, www.krankentaggeld.ch, www.rankentaggeld.ch, www.kgrankentaggeld.ch, www.grankentaggeld.ch, www.kbrankentaggeld.ch, www.brankentaggeld.ch, www.knrankentaggeld.ch, www.nrankentaggeld.ch, www.khrankentaggeld.ch, www.hrankentaggeld.ch, www.kyrankentaggeld.ch, www.yrankentaggeld.ch, www.klrankentaggeld.ch, www.lrankentaggeld.ch, www.korankentaggeld.ch, www.orankentaggeld.ch, www.kurankentaggeld.ch, www.urankentaggeld.ch, www.kirankentaggeld.ch, www.irankentaggeld.ch, www.kmrankentaggeld.ch, www.mrankentaggeld.ch, www.kankentaggeld.ch, www.kriankentaggeld.ch, www.kiankentaggeld.ch, www.kroankentaggeld.ch, www.koankentaggeld.ch, www.krlankentaggeld.ch, www.klankentaggeld.ch, www.krlankentaggeld.ch, www.klankentaggeld.ch, www.kr.ankentaggeld.ch, www.k.ankentaggeld.ch, www.krnkentaggeld.ch, www.kraonkentaggeld.ch, www.kronkentaggeld.ch, www.krapnkentaggeld.ch, www.krpnkentaggeld.ch, www.kra9nkentaggeld.ch, www.kr9nkentaggeld.ch, www.krankentaggeld.ch, www.krnkentaggeld.ch, www.krainkentaggeld.ch, www.krinkentaggeld.ch, www.kraunkentaggeld.ch, www.krunkentaggeld.ch, www.krakentaggeld.ch, www.krannkentaggeld.ch, www.krankentaggeld.ch, www.kranhkentaggeld.ch, www.krahkentaggeld.ch, www.kranjkentaggeld.ch, www.krajkentaggeld.ch, www.krankkentaggeld.ch, www.krakkentaggeld.ch, www.kranlkentaggeld.ch, www.kralkentaggeld.ch, www.kran kentaggeld.ch, www.kra kentaggeld.ch, www.kranentaggeld.ch, www.kranktentaggeld.ch, www.krantentaggeld.ch, www.krankentaggeld.ch, www.kranentaggeld.ch, www.krankgentaggeld.ch, www.krangentaggeld.ch, www.krankbentaggeld.ch, www.kranbentaggeld.ch, www.kranknentaggeld.ch, www.krannentaggeld.ch, www.krankhentaggeld.ch, www.kranhentaggeld.ch, www.krankyentaggeld.ch, www.kranyentaggeld.ch, www.kranklentaggeld.ch, www.kranlentaggeld.ch, www.krankoentaggeld.ch, www.kranoentaggeld.ch, www.krankuentaggeld.ch, www.kranuentaggeld.ch, www.krankientaggeld.ch, www.kranientaggeld.ch, www.krankmentaggeld.ch, www.kranmentaggeld.ch, www.krankntaggeld.ch, www.krankexntaggeld.ch, www.krankxntaggeld.ch, www.krankesntaggeld.ch, www.kranksntaggeld.ch, www.krankewntaggeld.ch, www.krankwntaggeld.ch, www.krankerntaggeld.ch, www.krankrntaggeld.ch, www.krankefntaggeld.ch, www.krankfntaggeld.ch, www.krankevntaggeld.ch, www.krankvntaggeld.ch, www.krankecntaggeld.ch, www.krankcntaggeld.ch, www.krankeqntaggeld.ch, www.krankqntaggeld.ch, www.krankeantaggeld.ch, www.krankantaggeld.ch, www.krankeyntaggeld.ch, www.krankyntaggeld.ch, www.kranketaggeld.ch, www.krankenntaggeld.ch, www.krankentaggeld.ch, www.krankenhtaggeld.ch, www.krankehtaggeld.ch, www.krankenjtaggeld.ch, www.krankejtaggeld.ch, www.krankenktaggeld.ch, www.krankektaggeld.ch, www.krankenltaggeld.ch, www.krankeltaggeld.ch, www.kranken taggeld.ch, www.kranke taggeld.ch, www.krankenaggeld.ch, www.krankentqaggeld.ch, www.krankenqaggeld.ch, www.krankentaaggeld.ch, www.krankenaaggeld.ch, www.krankent aggeld.ch, www.kranken aggeld.ch, www.krankentwaggeld.ch, www.krankenwaggeld.ch, www.krankenteaggeld.ch, www.krankeneaggeld.ch, www.krankentzaggeld.ch, www.krankenzaggeld.ch, www.krankentxaggeld.ch, www.krankenxaggeld.ch, www.krankentcaggeld.ch, www.krankencaggeld.ch, www.krankentggeld.ch, www.krankentaoggeld.ch, www.krankentoggeld.ch, www.krankentapggeld.ch, www.krankentpggeld.ch, www.krankenta9ggeld.ch, www.krankent9ggeld.ch, www.krankentaggeld.ch, www.krankentggeld.ch, www.krankentaiggeld.ch, www.krankentiggeld.ch, www.krankentauggeld.ch, www.krankentuggeld.ch, www.krankentageld.ch, www.krankentagsgeld.ch, www.krankentasgeld.ch, www.krankentagxgeld.ch, www.krankentaxgeld.ch, www.krankentagygeld.ch, www.krankentaygeld.ch, www.krankentaghgeld.ch, www.krankentahgeld.ch, www.krankentagngeld.ch, www.krankentangeld.ch, www.krankentagcgeld.ch, www.krankentacgeld.ch, www.krankentagdgeld.ch, www.krankentadgeld.ch, www.krankentagegeld.ch, www.krankentaegeld.ch, www.krankentagrgeld.ch, www.krankentargeld.ch, www.krankentagtgeld.ch, www.krankentatgeld.ch, www.krankentagbgeld.ch, www.krankentabgeld.ch, www.krankentagvgeld.ch, www.krankentavgeld.ch,

Other websites we recently analyzed

  1. SZEOB
    Hungary - 92.43.203.26
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Javascript, Php, Joomla
    Number of Javascript: 18
    Number of meta tags: 2
  2. HADI Maschinenbau GesmbH - Maschinen für die Akkumulatoren-Industrie
    Maschinen für die Akkumulatoren-Industrie - Machines for the accumulator industry
    Austria - 213.145.228.64
    Server software: Apache/1.3.34
    Technology: CSS, Html, Javascript, Php, Swf Object
    Number of Javascript: 1
    Number of meta tags: 5
  3. Nicolaasparochie Amsterdam
    Netherlands - 188.93.150.44
    Server software: Apache/2.2.16 (Debian)
    Technology: CSS, Html, Javascript, jQuery UI, Php, Facebook Box
    Number of Javascript: 12
    Number of meta tags: 3
  4. Common Thread Ministries - Home
    Houston (United States) - 192.254.236.52
    Server software: nginx/1.10.1
    Technology: CSS, Google Font API, Html, Html5
    Number of Javascript: 2
    Number of meta tags: 1
  5. kinderopvangwatergraafsmeer.amsterdam
    Netherlands - 188.93.150.35
    Server software: Apache/2.4.10
    Technology: Html
  6. wvpp.net
    Ottawa (Canada) - 47.90.14.232
    Server software: Microsoft-IIS/7.5
    Technology: Html, Php
    Number of Javascript: 1
    Number of meta tags: 1
  7. postoakfinancialadvisors.com
    Scottsdale (United States) - 50.63.202.65
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  8. Comedian ANT Standup Comedy
    Comedian ANT and his standup comedy and comic
    Scottsdale (United States) - 50.63.202.4
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 2
  9. Serenity of Spirit - Home
    San Francisco (United States) - 199.34.228.79
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 3
    Number of meta tags: 1
  10. Home
    San Francisco (United States) - 199.34.228.46
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 6
    Number of meta tags: 2

Check Other Websites